PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA19433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 294aa    MW: 34407.9 Da    PI: 4.8286
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA19433genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK74.61.2e-23186233552
                     RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                +++++++++F+ pi+ AAk++++++T+LKr+CR+++I+RWPhRk+ksl
  Tp57577_TGAC_v2_mRNA19433 186 LQFDEIKEHFDVPITMAAKKMNIGVTLLKRRCRELNINRWPHRKLKSL 233
                                899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.54173254IPR003035RWP-RK domain
PfamPF020421.4E-20186233IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MDFFAKPETS YWFCNDQSQQ NDTDKIMDMT PYDDFVNIDW ANHFSYQSNK LFLNEFHDLE  60
NFNFDFNLPN LDENLDVEQK PTNVVFPELV HNTEKVESVC ESAFSETSEK VGKGLMSFVK  120
KEEEWENQDS PFGGNDFSFA ESGFVETFAK HGNEFLNFVK NENEEFSIPL TLPSSNVIMK  180
KKSSLLQFDE IKEHFDVPIT MAAKKMNIGV TLLKRRCREL NINRWPHRKL KSLMLLIDNL  240
KEMGLEDEVA MLEKEKKMLE EIPGMELNAE IKKLRQSFFK ANYKKRRSNT FHP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602270.11e-104RWP-RK domain protein
TrEMBLG7J7G01e-104G7J7G0_MEDTR; RWP-RK domain protein
STRINGGLYMA06G13540.21e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.14e-31RWP-RK domain-containing protein